
원본
Atlas Antibodies Anti-TRAM1 Antibody
상품 한눈에 보기
Human TRAM1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(마우스 86%, 랫트 84%)을 보임. 40% glycerol 및 PBS buffer에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023929-100 Anti-TRAM1 Antibody, translocation associated membrane protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023929-25 Anti-TRAM1 Antibody, translocation associated membrane protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRAM1 Antibody
Anti-TRAM1 Antibody
Target: translocation associated membrane protein 1 (TRAM1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human TRAM1.
Alternative Gene Names
- TRAM
- TRAMP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocation associated membrane protein 1 |
| Target Gene | TRAM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNK |
Species Reactivity
| 종 | 항원 서열 유사도 |
|---|---|
| Human | 100% |
| Mouse | 86% |
| Rat | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



