CacheBy
Atlas Antibodies Anti-TRAM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRAM2 Antibody

상품 한눈에 보기

Human TRAM2 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity Purified 제품입니다. IHC 등 다양한 응용에 적합하며, 높은 종 간 일치도를 보입니다. 40% 글리세롤과 PBS 버퍼에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057925-100 Anti-TRAM2 Antibody, translocation associated membrane protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057925-25 Anti-TRAM2 Antibody, translocation associated membrane protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRAM2 Antibody

Anti-TRAM2 Antibody

Target Information

  • Target Protein: translocation associated membrane protein 2
  • Target Gene: TRAM2
  • Alternative Gene Names: KIAA0057

면역조직화학(IHC) 등 다양한 연구 응용에 사용 가능

Product Description

Polyclonal Antibody against Human TRAM2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
AFLFILPQYNISVPTADSETVHYHYGPKDL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000041779 (100%)
  • Rat ENSRNOG00000013046 (90%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Datasheet

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.