Atlas Antibodies Anti-TPK1 Antibody

상품 한눈에 보기

인간 TPK1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 발현 검증 완료. 토끼 유래 IgG, 친화성 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021545-100 Anti-TPK1 Antibody, thiamin pyrophosphokinase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021545-25 Anti-TPK1 Antibody, thiamin pyrophosphokinase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: thiamin pyrophosphokinase 1 (TPK1)
Supplier: Atlas Antibodies

Recombinant expression validation:
검증된 WB 실험에서 표적 단백질 과발현을 통해 재조합 발현 검증 완료.

Polyclonal Antibody against Human TPK1

항목	내용
Target Protein	thiamin pyrophosphokinase 1
Target Gene	TPK1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (94%), Rat (91%)

Antigen Sequence:
HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand