CacheBy
Atlas Antibodies Anti-TPK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPK1 Antibody

상품 한눈에 보기

인간 TPK1 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB(재조합 발현 검증), ICC에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었고, 마우스 및 랫과 높은 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021849-100 Anti-TPK1 Antibody, thiamin pyrophosphokinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021849-25 Anti-TPK1 Antibody, thiamin pyrophosphokinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPK1 Antibody

Anti-TPK1 Antibody

Target: thiamin pyrophosphokinase 1 (TPK1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TPK1 (thiamin pyrophosphokinase 1).


Alternative Gene Names

HTPK1, PP20

Open Datasheet


Specifications

항목 내용
Target Protein Thiamin pyrophosphokinase 1
Target Gene TPK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029735 (94%)
Rat ENSRNOG00000029922 (91%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.