CacheBy
Atlas Antibodies Anti-TPD52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPD52 Antibody

상품 한눈에 보기

Human TPD52 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식의 Affinity purified 제품입니다. IHC 및 RNA-seq 데이터 기반 정합 검증을 통해 단백질 발현을 교차 확인할 수 있습니다. Human에 반응하며 D52, hD52, N8L 유전자 대체명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062167-100 Anti-TPD52 Antibody, tumor protein D52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062167-25 Anti-TPD52 Antibody, tumor protein D52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPD52 Antibody

Anti-TPD52 Antibody

Target: Tumor protein D52

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TPD52

Alternative Gene Names

D52, hD52, N8L

Open Datasheet

Target Information

항목 내용
Target Protein Tumor protein D52
Target Gene TPD52
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTL

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000011441 78%
Mouse ENSMUSG00000027506 76%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.