CacheBy
Atlas Antibodies Anti-TPD52L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPD52L1 Antibody

상품 한눈에 보기

인간 TPD52L1 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit 호스트에서 생산되며 IgG 아이소타입을 가집니다. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. Human 종에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027915-100 Anti-TPD52L1 Antibody, tumor protein D52-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027915-25 Anti-TPD52L1 Antibody, tumor protein D52-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPD52L1 Antibody

Anti-TPD52L1 Antibody

Target: Tumor protein D52-like 1 (TPD52L1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TPD52L1.


Alternative Gene Names

  • D53
  • hD53

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000021478 82%
Mouse ENSMUSG00000000296 80%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.