Atlas Antibodies Anti-TOR1B Antibody

상품 한눈에 보기

Human TOR1B 단백질을 인식하는 토끼 다클론 항체로, IHC 및 WB에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. 인간, 생쥐, 랫드 반응성이 검증되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA013403-100 Anti-TOR1B Antibody, torsin family 1, member B (torsin B) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA013403-25 Anti-TOR1B Antibody, torsin family 1, member B (torsin B) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TOR1B Antibody

Anti-TOR1B Antibody

Target Information

Target Protein: torsin family 1, member B (torsin B)
Target Gene: TOR1B
Alternative Gene Names: DQ1, MGC4386

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody against human TOR1B.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH

Species Reactivity

Verified Reactivity: Human, Mouse, Rat
Interspecies Identity:
- Rat ENSRNOG00000006435 (93%)
- Mouse ENSMUSG00000026848 (93%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.