Atlas Antibodies Anti-TOR1B Antibody

상품 한눈에 보기

Human TOR1B 단백질을 표적으로 하는 토르신 B 폴리클로날 항체. IHC 및 WB에 적합하며 Rabbit에서 생산된 IgG 항체. Affinity purification 방식으로 높은 특이성과 재현성을 보장. Human, Mouse, Rat 종에 반응성이 검증됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA013697-100 Anti-TOR1B Antibody, torsin family 1, member B (torsin B) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA013697-25 Anti-TOR1B Antibody, torsin family 1, member B (torsin B) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TOR1B Antibody

Anti-TOR1B Antibody

Target Information

Protein: torsin family 1, member B (torsin B)
Gene: TOR1B
Alternative Gene Names: DQ1, MGC4386

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody against Human TOR1B.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

Species	Ortholog ID	Sequence Identity
Mouse	ENSMUSG00000026848	93%
Rat	ENSRNOG00000006435	93%

Antibody Specifications

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand