CacheBy
Atlas Antibodies Anti-TOM1L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOM1L1 Antibody

상품 한눈에 보기

Human TOM1L1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, SRCASM 유전자 대체명으로도 알려짐. 인체 반응성이 검증된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022916-100 Anti-TOM1L1 Antibody, target of myb1 (chicken)-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022916-25 Anti-TOM1L1 Antibody, target of myb1 (chicken)-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOM1L1 Antibody

Anti-TOM1L1 Antibody

Target of myb1 (chicken)-like 1


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human TOM1L1.


Alternative Gene Names

  • SRCASM

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein target of myb1 (chicken)-like 1
Target Gene TOM1L1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence WSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMS

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000020541 84%
Rat ENSRNOG00000002474 81%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.