CacheBy
Atlas Antibodies Anti-TOM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOM1 Antibody

상품 한눈에 보기

Human TOM1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제되었습니다. Human에 대한 반응성이 검증되었으며, 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001749-100 Anti-TOM1 Antibody, target of myb1 (chicken) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001749-25 Anti-TOM1 Antibody, target of myb1 (chicken) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOM1 Antibody

Anti-TOM1 Antibody

Target of Myb1 membrane trafficking protein


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TOM1
Open Datasheet


Target Information

항목 내용
Target Protein Target of Myb1 membrane trafficking protein
Target Gene TOM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 서열 유사도
Mouse ENSMUSG00000042870 90%
Rat ENSRNOG00000014093 89%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.