Atlas Antibodies Anti-TNR Antibody

상품 한눈에 보기

Human TNR 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 RNA-seq 기반 Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, 인체 시료에 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027150-100 Anti-TNR Antibody, tenascin R 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027150-25 Anti-TNR Antibody, tenascin R 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: tenascin R
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human TNR.
Open Datasheet

항목	내용
Target Protein	tenascin R
Target Gene	TNR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALK
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000015829 (99%), Rat ENSRNOG00000002468 (97%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)