Atlas Antibodies Anti-TNR Antibody

상품 한눈에 보기

Human TNR 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG 형태이며, PrEST 항원으로 Affinity 정제됨. Human, Mouse, Rat 종에 반응.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029859-100 Anti-TNR Antibody, tenascin R 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029859-25 Anti-TNR Antibody, tenascin R 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: tenascin R
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human TNR
Open Datasheet (PDF)

항목	내용
Target Protein	tenascin R
Target Gene	TNR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALK
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000015829 (99%), Rat ENSRNOG00000002468 (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.