CacheBy
Atlas Antibodies Anti-TNC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TNC Antibody

상품 한눈에 보기

Human TNC(tenascin C)를 표적으로 하는 rabbit polyclonal antibody. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. PBS/glycerol buffer에 보존된 안정한 포맷.

카탈로그번호
HPA004823-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004823-100 Anti-TNC Antibody, tenascin C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004823-25 Anti-TNC Antibody, tenascin C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNC Antibody

Anti-TNC Antibody

Target: Tenascin C (TNC)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human tenascin C (TNC).

Alternative Gene Names

DFNA56, HXB, MGC167029, TN

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Tenascin C
Target Gene TNC
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000058645 (86%), Mouse ENSMUSG00000028364 (84%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.