CacheBy
Atlas Antibodies Anti-TMX2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMX2 Antibody

상품 한눈에 보기

Human TMX2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었으며 Affinity 정제됨. IHC 등 다양한 응용에 적합. TMX2의 ortholog에 대해 높은 교차 반응성을 보임. 안정화된 PBS buffer(40% glycerol, 0.02% sodium azide)로 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040282-100 Anti-TMX2 Antibody, thioredoxin-related transmembrane protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040282-25 Anti-TMX2 Antibody, thioredoxin-related transmembrane protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMX2 Antibody

Anti-TMX2 Antibody

Target: thioredoxin-related transmembrane protein 2 (TMX2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TMX2, produced in rabbit and affinity purified using the PrEST antigen as ligand.

Alternative Gene Names

PDIA12, TXNDC14

  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein thioredoxin-related transmembrane protein 2
Target Gene TMX2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000005308 (99%)
  • Mouse ENSMUSG00000050043 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.