Atlas Antibodies Anti-GABBR2 Antibody

상품 한눈에 보기

Human GABBR2 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. Human에 반응하며 Mouse, Rat과 99% 서열 동일성.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA013820-100 Anti-GABBR2 Antibody, gamma-aminobutyric acid (GABA) B receptor, 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA013820-25 Anti-GABBR2 Antibody, gamma-aminobutyric acid (GABA) B receptor, 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GABBR2 Antibody

Anti-GABBR2 Antibody

Target: gamma-aminobutyric acid (GABA) B receptor, 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human GABBR2.

Alternative Gene Names

GABABR2, GPR51, GPRC3B, HG20, GPRC3B

Open Datasheet

Target Information

항목	내용
Target Protein	gamma-aminobutyric acid (GABA) B receptor, 2
Target Gene	GABBR2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000039809 (99%), Rat ENSRNOG00000008431 (99%)

Antigen Sequence:

SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand