Atlas Antibodies Anti-GABARAPL1 Antibody

상품 한눈에 보기

Human GABARAPL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA065883-100 Anti-GABARAPL1 Antibody, GABA(A) receptor-associated protein like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA065883-25 Anti-GABARAPL1 Antibody, GABA(A) receptor-associated protein like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: GABA(A) receptor-associated protein like 1
Supplier: Atlas Antibodies

면역조직화학 (IHC) 등 다양한 연구용 응용에 적합

Polyclonal Antibody against Human GABARAPL1

APG8L, ATG8B, ATG8L, gec1

항목	내용
Target Protein	GABA(A) receptor-associated protein like 1
Target Gene	GABARAPL1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000055415 (27%), Rat ENSRNOG00000017203 (26%)

Antigen Sequence:
TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet	Material Safety Data Sheet