CacheBy
Atlas Antibodies Anti-FZD8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FZD8 Antibody

상품 한눈에 보기

Human FZD8 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045025-100 Anti-FZD8 Antibody, frizzled class receptor 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045025-25 Anti-FZD8 Antibody, frizzled class receptor 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FZD8 Antibody

Anti-FZD8 Antibody

Target: frizzled class receptor 8 (FZD8)
Type: Polyclonal Antibody against Human FZD8

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody raised in rabbit against human FZD8.
Open Datasheet (PDF)

Target Information

항목 내용
Target Protein frizzled class receptor 8
Target Gene FZD8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Verified Species Reactivity Human
Interspecies Identity Rat (100%, ENSRNOG00000061031), Mouse (100%, ENSMUSG00000036904)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.