
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-G2E3 Antibody
상품 한눈에 보기
Human G2E3 단백질을 타깃으로 하는 rabbit polyclonal 항체. G2/M-phase 특이적 E3 유비퀴틴 리가아제 검출에 적합. PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001601-100 Anti-G2E3 Antibody, G2/M-phase specific E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001601-25 Anti-G2E3 Antibody, G2/M-phase specific E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-G2E3 Antibody
Anti-G2E3 Antibody
Target: G2/M-phase specific E3 ubiquitin protein ligase
Type: Polyclonal Antibody against Human G2E3
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합
Product Description
Human G2E3 단백질을 인식하는 rabbit polyclonal 항체입니다.
PrEST 항원을 사용하여 친화 정제되었습니다.
Alternative Gene Names
FLJ20333, KIAA1333, PHF7B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G2/M-phase specific E3 ubiquitin protein ligase |
| Target Gene | G2E3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat (81%), Mouse (74%) |
Antigen Sequence
IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 사용 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



