CacheBy
Atlas Antibodies Anti-FXR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FXR1 Antibody

상품 한눈에 보기

Human FXR1 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 고순도 PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055475-100 Anti-FXR1 Antibody, fragile X mental retardation, autosomal homolog 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055475-25 Anti-FXR1 Antibody, fragile X mental retardation, autosomal homolog 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FXR1 Antibody

Anti-FXR1 Antibody

Target: fragile X mental retardation, autosomal homolog 1 (FXR1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human FXR1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein fragile X mental retardation, autosomal homolog 1
Target Gene FXR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000027680 (97%), Rat ENSRNOG00000051480 (97%)

Antigen Sequence

TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.