CacheBy
Atlas Antibodies Anti-FUZ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FUZ Antibody

상품 한눈에 보기

Human FUZ 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Recombinant expression을 통한 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

카탈로그번호
HPA041779-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041779-100 Anti-FUZ Antibody, fuzzy planar cell polarity protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041779-25 Anti-FUZ Antibody, fuzzy planar cell polarity protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FUZ Antibody

Anti-FUZ Antibody

Target: fuzzy planar cell polarity protein (FUZ)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • IHC (Immunohistochemistry)
  • WB (Western Blot, validated with recombinant expression)
  • ICC (Immunocytochemistry)

Recombinant expression validation:
Validation performed in WB using target protein overexpression.


Product Description

Polyclonal antibody against human FUZ protein.


Alternative Gene Names

  • FLJ22688
  • Fy

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein fuzzy planar cell polarity protein
Target Gene FUZ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
Verified Species Reactivity Human
Interspecies Identity Mouse (ENSMUSG00000011658, 78%), Rat (ENSRNOG00000053084, 78%)

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Validation
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.