CacheBy
Atlas Antibodies Anti-FTCD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FTCD Antibody

상품 한눈에 보기

Human FTCD 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 기반 정량 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030928-100 Anti-FTCD Antibody, formimidoyltransferase cyclodeaminase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030928-25 Anti-FTCD Antibody, formimidoyltransferase cyclodeaminase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FTCD Antibody

Anti-FTCD Antibody

Target Protein: formimidoyltransferase cyclodeaminase (FTCD)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human FTCD.
Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MRLPKNIPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWLALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000001261 75%
Mouse ENSMUSG00000001155 75%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Preservative Sodium azide (0.02%)
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.