CacheBy
Atlas Antibodies Anti-FTCD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FTCD Antibody

상품 한눈에 보기

인간 FTCD 단백질을 인식하는 폴리클로날 토끼 항체로, IHC에서 RNA-seq 데이터와 비교한 직교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol 완충액에 보존. 다양한 조직 발현 분석 및 단백질 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020073-100 Anti-FTCD Antibody, formimidoyltransferase cyclodeaminase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020073-25 Anti-FTCD Antibody, formimidoyltransferase cyclodeaminase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FTCD Antibody

Anti-FTCD Antibody

Target Protein: formimidoyltransferase cyclodeaminase (FTCD)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human FTCD
Open Datasheet

Target Information

항목 내용
Target Protein formimidoyltransferase cyclodeaminase
Target Gene FTCD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Amino Acid Sequence MRLPKNIPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWLALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRV
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000001261 (75%), Mouse ENSMUSG00000001155 (75%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.