Atlas Antibodies Anti-FSD1L Antibody

상품 한눈에 보기

Human FSD1L 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 응용에 적합합니다. Rabbit IgG 형식이며 PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었고, glycerol/PBS buffer에 보존되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035138-100 Anti-FSD1L Antibody, fibronectin type III and SPRY domain containing 1-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035138-25 Anti-FSD1L Antibody, fibronectin type III and SPRY domain containing 1-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: fibronectin type III and SPRY domain containing 1-like
Supplier: Atlas Antibodies

면역조직화학 (IHC) 등 다양한 면역학적 분석에 사용 가능

Polyclonal Antibody against Human FSD1L

항목	내용
Target Protein	fibronectin type III and SPRY domain containing 1-like
Target Gene	FSD1L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000059876 (95%), Mouse ENSMUSG00000054752 (92%)

Antigen Sequence:
MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)