CacheBy
Atlas Antibodies Anti-FSHB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FSHB Antibody

상품 한눈에 보기

사람 FSHB 단백질을 인식하는 폴리클로날 항체로 면역조직화학(IHC) 등 다양한 연구용에 적합. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 사람에 대해 검증되었으며, 마우스·랫과 높은 서열 유사성을 가짐. 글리세롤과 PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069703-100 Anti-FSHB Antibody, follicle stimulating hormone, beta polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069703-25 Anti-FSHB Antibody, follicle stimulating hormone, beta polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FSHB Antibody

Anti-FSHB Antibody

Target: Follicle Stimulating Hormone, Beta Polypeptide (FSHB)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human FSHB.

Open Datasheet

Target Information

  • Target Protein: Follicle stimulating hormone, beta polypeptide
  • Target Gene: FSHB
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000027120) – 87%
  • Rat (ENSRNOG00000004898) – 85%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Storage Store at recommended conditions; mix gently before use
Notes Optimal concentrations and conditions should be determined by the user

Material Safety Data Sheet (Sodium Azide)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.