
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FSHB Antibody
상품 한눈에 보기
사람 FSHB 단백질을 인식하는 폴리클로날 항체로 면역조직화학(IHC) 등 다양한 연구용에 적합. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 사람에 대해 검증되었으며, 마우스·랫과 높은 서열 유사성을 가짐. 글리세롤과 PBS 완충액에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA069703-100 Anti-FSHB Antibody, follicle stimulating hormone, beta polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069703-25 Anti-FSHB Antibody, follicle stimulating hormone, beta polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FSHB Antibody
Anti-FSHB Antibody
Target: Follicle Stimulating Hormone, Beta Polypeptide (FSHB)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human FSHB.
Target Information
- Target Protein: Follicle stimulating hormone, beta polypeptide
- Target Gene: FSHB
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000027120) – 87%
- Rat (ENSRNOG00000004898) – 85%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage | Store at recommended conditions; mix gently before use |
| Notes | Optimal concentrations and conditions should be determined by the user |
Material Safety Data Sheet (Sodium Azide)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



