CacheBy
Atlas Antibodies Anti-FOXQ1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FOXQ1 Antibody

상품 한눈에 보기

Human FOXQ1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. PBS와 glycerol buffer에 보존되어 안정적인 사용이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059700-100 Anti-FOXQ1 Antibody, forkhead box Q1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059700-25 Anti-FOXQ1 Antibody, forkhead box Q1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FOXQ1 Antibody

Anti-FOXQ1 Antibody

Target Information

  • Target Protein: forkhead box Q1
  • Target Gene: FOXQ1
  • Alternative Gene Names: HFH1

Product Description

Polyclonal Antibody against Human FOXQ1.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000038415 100%
Rat ENSRNOG00000006293 59%

Antibody Details

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.