CacheBy
Atlas Antibodies Anti-FOXO4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FOXO4 Antibody

상품 한눈에 보기

인간 FOXO4 단백질을 인식하는 폴리클로날 항체로 웨스턴 블롯(WB) 및 면역세포화학(ICC)에 적합. 토끼에서 생산된 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. FOXO4 관련 연구 및 단백질 발현 분석에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039560-100 Anti-FOXO4 Antibody, forkhead box O4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039560-25 Anti-FOXO4 Antibody, forkhead box O4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FOXO4 Antibody

Anti-FOXO4 Antibody

Target Information

  • Target Protein: forkhead box O4
  • Target Gene: FOXO4
  • Alternative Gene Names: AFX1, MLLT7

Product Description

Polyclonal antibody against human FOXO4.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG

Species Reactivity

  • Verified Species: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000042903): 87%
    • Rat (ENSRNOG00000033316): 85%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.