Atlas Antibodies Anti-FLOT2 Antibody

상품 한눈에 보기

Human FLOT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증이 완료되었습니다. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA071038-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071038-100 Anti-FLOT2 Antibody, flotillin 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071038-25 Anti-FLOT2 Antibody, flotillin 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-FLOT2 Antibody

Anti-FLOT2 Antibody

Target: flotillin 2 (FLOT2)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 교차 검증
WB (Western Blot)

Product Description

Polyclonal antibody against Human FLOT2.

Alternative Gene Names

ECS-1, ECS1, ESA, ESA1, M17S1

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	flotillin 2
Target Gene	FLOT2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000009681 (100%), Mouse ENSMUSG00000061981 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.