CacheBy
Atlas Antibodies Anti-FLOT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FLOT2 Antibody

상품 한눈에 보기

인간 FLOT2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Rabbit에서 생산되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001396-100 Anti-FLOT2 Antibody, flotillin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001396-25 Anti-FLOT2 Antibody, flotillin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FLOT2 Antibody

Anti-FLOT2 Antibody

Target: flotillin 2
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human FLOT2


Alternative Gene Names

ECS-1, ECS1, ESA, ESA1, M17S1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein flotillin 2
Target Gene FLOT2
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000009681 100%
Mouse ENSMUSG00000061981 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.