CacheBy
Atlas Antibodies Anti-FLI1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FLI1 Antibody

상품 한눈에 보기

Human FLI1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC와 WB에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, 다양한 종 간 교차 반응성이 검증되었습니다. 40% glycerol/PBS buffer로 안정화되어 장기 보관이 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073099-100 Anti-FLI1 Antibody, Fli-1 proto-oncogene, ETS transcription factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073099-25 Anti-FLI1 Antibody, Fli-1 proto-oncogene, ETS transcription factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FLI1 Antibody

Anti-FLI1 Antibody

Target: Fli-1 proto-oncogene, ETS transcription factor
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human FLI1.


Alternative Gene Names

EWSR2, SIC-1

Open Datasheet


Target Information

항목 내용
Target Protein Fli-1 proto-oncogene, ETS transcription factor
Target Gene FLI1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
Verified Species Reactivity Human
Interspecies Identity Mouse (90%), Rat (87%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.