CacheBy
Atlas Antibodies Anti-FLI1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FLI1 Antibody

상품 한눈에 보기

인간 FLI1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되며 IgG 아이소타입을 가지며, PrEST 항원으로 정제되었습니다. 높은 종 간 보존성을 보여 인간, 마우스, 랫트에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065030-100 Anti-FLI1 Antibody, Fli-1 proto-oncogene, ETS transcription factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065030-25 Anti-FLI1 Antibody, Fli-1 proto-oncogene, ETS transcription factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FLI1 Antibody

Anti-FLI1 Antibody

Target Information

  • Target Protein: Fli-1 proto-oncogene, ETS transcription factor
  • Target Gene: FLI1
  • Alternative Gene Names: EWSR2, SIC-1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human FLI1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000016087 90%
Rat ENSRNOG00000008904 87%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resource

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.