CacheBy
Atlas Antibodies Anti-TMEM72 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM72 Antibody

상품 한눈에 보기

Human TMEM72 단백질을 인식하는 Rabbit Polyclonal 항체. IHC를 포함한 단백질 발현 분석에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039894-100 Anti-TMEM72 Antibody, transmembrane protein 72 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039894-25 Anti-TMEM72 Antibody, transmembrane protein 72 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM72 Antibody

Anti-TMEM72 Antibody

Target: Transmembrane protein 72 (TMEM72)
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human TMEM72.


Alternative Gene Names

bA285G1.3, C10orf127, KSP37

Open Datasheet


Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    KRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSA

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Mouse ENSMUSG00000048108 (82%)
    • Rat ENSRNOG00000023340 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.