CacheBy
Atlas Antibodies Anti-TMEM71 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM71 Antibody

상품 한눈에 보기

Human TMEM71 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 포맷으로 제공됩니다. 인간 시료에 검증되었으며, 사용 전 부드럽게 혼합하는 것이 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070655-100 Anti-TMEM71 Antibody, transmembrane protein 71 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070655-25 Anti-TMEM71 Antibody, transmembrane protein 71 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM71 Antibody

Anti-TMEM71 Antibody

Target Information

  • Target Protein: transmembrane protein 71
  • Target Gene: TMEM71
  • Alternative Gene Names: FLJ33069

Product Description

Polyclonal antibody against human TMEM71, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SLTDDWESGKMNAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000036944): 43%
  • Rat (ENSRNOG00000025460): 40%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications IHC, ICC
Verified Reactivity Human

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.