CacheBy
Atlas Antibodies Anti-TMEM30B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM30B Antibody

상품 한눈에 보기

Human TMEM30B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. CDC50B 유전자 대체명으로도 알려져 있으며, PrEST 항원을 이용해 친화 정제됨. 고순도 IgG 항체로 인간 시료에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043162-100 Anti-TMEM30B Antibody, transmembrane protein 30B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043162-25 Anti-TMEM30B Antibody, transmembrane protein 30B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM30B Antibody

Anti-TMEM30B Antibody

Target: transmembrane protein 30B (TMEM30B)
Supplier: Atlas Antibodies


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against human TMEM30B.


Alternative Gene Names

CDC50B

Open Datasheet


Target Information

항목 내용
Target Protein transmembrane protein 30B
Target Gene TMEM30B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNEC

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000034435 (85%)
  • Rat ENSRNOG00000008046 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.