CacheBy
Atlas Antibodies Anti-TMEM268 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM268 Antibody

상품 한눈에 보기

Human TMEM268 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, 높은 종간 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017199-100 Anti-TMEM268 Antibody, transmembrane protein 268 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017199-25 Anti-TMEM268 Antibody, transmembrane protein 268 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM268 Antibody

Anti-TMEM268 Antibody

Target Information

  • Target Protein: transmembrane protein 268
  • Target Gene: TMEM268
  • Alternative Gene Names: C9orf91, DKFZp547P234, FLJ38045
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TMEM268.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000045917 88%
Rat ENSRNOG00000008712 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.