CacheBy
Atlas Antibodies Anti-TMEM19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM19 Antibody

상품 한눈에 보기

Human TMEM19 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. 40% 글리세롤 기반 완충액에 보존되어 장기 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA016830-100 Anti-TMEM19 Antibody, transmembrane protein 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016830-25 Anti-TMEM19 Antibody, transmembrane protein 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM19 Antibody

Anti-TMEM19 Antibody

Target: Transmembrane protein 19 (TMEM19)
Type: Polyclonal antibody against Human TMEM19
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Rabbit polyclonal antibody raised against human TMEM19, a transmembrane protein. The antibody was affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ10936

Target Information

항목 내용
Target Protein Transmembrane protein 19
Target Gene TMEM19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YTGLDESTGMVVNSPTNKARHIAGKPILDN
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000069520 (70%), Rat ENSRNOG00000003985 (70%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.