CacheBy
Atlas Antibodies Anti-TMEM186 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM186 Antibody

상품 한눈에 보기

Human TMEM186 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 WB 검증 완료. Recombinant expression 기반 검증으로 높은 특이성 확보. 친화 정제된 고품질 항체로 다양한 연구 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063559-100 Anti-TMEM186 Antibody, transmembrane protein 186 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063559-25 Anti-TMEM186 Antibody, transmembrane protein 186 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM186 Antibody

Anti-TMEM186 Antibody

Target: transmembrane protein 186 (TMEM186)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human TMEM186.


Alternative Gene Names

C16orf51, DKFZP564K2062

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane protein 186
Target Gene TMEM186
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEKLPNAETEKFWMFYRFDAI

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000043140 66%
Rat ENSRNOG00000027087 62%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.