CacheBy
Atlas Antibodies Anti-TMEM102 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM102 Antibody

상품 한눈에 보기

Human TMEM102 단백질에 대한 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 형 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제된 제품이며, 인체 반응성 확인 및 다양한 종 간 서열 비교 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024433-100 Anti-TMEM102 Antibody, transmembrane protein 102 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024433-25 Anti-TMEM102 Antibody, transmembrane protein 102 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM102 Antibody

Anti-TMEM102 Antibody

Target: Transmembrane protein 102 (TMEM102)
Type: Polyclonal antibody against Human TMEM102


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody targeting Human TMEM102, validated for use in IHC and WB.
Produced in rabbit and affinity purified using the PrEST antigen as ligand.


Alternative Gene Names

  • FLJ36878

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

HAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDLESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESEESSKDWQSSVDQPHSYVTEHE

Species Reactivity

  • Verified: Human

Interspecies Identity:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Mouse | ENSMUSG00000089876 | 66% |
| Rat | ENSRNOG00000015057 | 62% |


Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.