Atlas Antibodies Anti-TMEM102 Antibody

상품 한눈에 보기

Human TMEM102 단백질에 대한 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 형 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제된 제품이며, 인체 반응성 확인 및 다양한 종 간 서열 비교 정보 제공.

카탈로그번호: HPA024433-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024433-100 Anti-TMEM102 Antibody, transmembrane protein 102 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024433-25 Anti-TMEM102 Antibody, transmembrane protein 102 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TMEM102 Antibody

Anti-TMEM102 Antibody

Target: Transmembrane protein 102 (TMEM102)
Type: Polyclonal antibody against Human TMEM102

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody targeting Human TMEM102, validated for use in IHC and WB.
Produced in rabbit and affinity purified using the PrEST antigen as ligand.

Alternative Gene Names

FLJ36878

Open Datasheet (PDF)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

HAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDLESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESEESSKDWQSSVDQPHSYVTEHE

Species Reactivity

Verified: Human

Interspecies Identity:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Mouse | ENSMUSG00000089876 | 66% |
| Rat | ENSRNOG00000015057 | 62% |

Product Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.