
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMEM106C Antibody
상품 한눈에 보기
Human TMEM106C 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 오쏘고날 검증에 적합. Rabbit 유래 IgG로, PrEST 항원 친화 정제. 높은 인종 간 반응성 확인 및 안전한 보존용액 포함.
- 카탈로그번호
- HPA047204-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047204-100 Anti-TMEM106C Antibody, transmembrane protein 106C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047204-25 Anti-TMEM106C Antibody, transmembrane protein 106C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMEM106C Antibody
Anti-TMEM106C Antibody
Transmembrane protein 106C
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human TMEM106C.
Alternative Gene Names
- MGC5576
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Transmembrane protein 106C |
| Target Gene | TMEM106C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SVKISYIGLMTQSSLETHHYVDCGGNSTAI |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000052369 (77%), Rat ENSRNOG00000053269 (67%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



