CacheBy
Atlas Antibodies Anti-TKT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TKT Antibody

상품 한눈에 보기

Human TKT 단백질을 인식하는 폴리클로나 항체로 IHC, WB, ICC 등 다양한 응용에 적합함. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Rabbit 유래 IgG, 프레스티 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029480-100 Anti-TKT Antibody, transketolase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029480-25 Anti-TKT Antibody, transketolase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TKT Antibody

Anti-TKT Antibody

Target Protein: transketolase
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Orthogonal Validation
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC


Product Description

Polyclonal antibody against Human TKT (transketolase)
Open Datasheet


Specifications

항목 내용
Target Protein transketolase
Target Gene TKT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000016064 (84%), Mouse ENSMUSG00000021957 (84%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.