Atlas Antibodies Anti-TKT Antibody

상품 한눈에 보기

Human TKT 단백질을 인식하는 폴리클로나 항체로 IHC, WB, ICC 등 다양한 응용에 적합함. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Rabbit 유래 IgG, 프레스티 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

카탈로그번호: HPA029480-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029480-100 Anti-TKT Antibody, transketolase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029480-25 Anti-TKT Antibody, transketolase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TKT Antibody

Anti-TKT Antibody

Target Protein: transketolase
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Orthogonal Validation
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC

Product Description

Polyclonal antibody against Human TKT (transketolase)
Open Datasheet

Specifications

항목	내용
Target Protein	transketolase
Target Gene	TKT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	HYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000016064 (84%), Mouse ENSMUSG00000021957 (84%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.