CacheBy
Atlas Antibodies Anti-TK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TK2 Antibody

상품 한눈에 보기

Human TK2 단백질을 인식하는 Rabbit Polyclonal 항체로, 미토콘드리아 티미딘 키나아제 2 검출에 적합합니다. Affinity purification 방식으로 제조되었으며, 인체 시료에 높은 반응성을 보입니다. IHC 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA041162-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041162-100 Anti-TK2 Antibody, thymidine kinase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041162-25 Anti-TK2 Antibody, thymidine kinase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TK2 Antibody

Anti-TK2 Antibody

Target: Thymidine kinase 2, mitochondrial (TK2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human TK2.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Thymidine kinase 2, mitochondrial
Target Gene TK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRD
Verified Species Reactivity Human
Interspecies Identity Rat (81%), Mouse (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.