CacheBy
Atlas Antibodies Anti-TJAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TJAP1 Antibody

상품 한눈에 보기

Human TJAP1을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030164-100 Anti-TJAP1 Antibody, tight junction associated protein 1 (peripheral) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030164-25 Anti-TJAP1 Antibody, tight junction associated protein 1 (peripheral) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TJAP1 Antibody

Anti-TJAP1 Antibody

Target: Tight junction associated protein 1 (peripheral)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TJAP1.

Alternative Gene Names

  • PILT
  • TJP4

Open Datasheet

Target Information

항목 내용
Target Protein Tight junction associated protein 1 (peripheral)
Target Gene TJAP1
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000012296 (88%), Rat ENSRNOG00000018980 (83%)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.