CacheBy
Atlas Antibodies Anti-TJAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TJAP1 Antibody

상품 한눈에 보기

Human TJAP1 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 Western blot에 적합. PrEST 항원으로 친화 정제됨. 인간, 생쥐, 랫트 반응성 검증 완료. 안정적 PBS/glycerol buffer에 보존.

카탈로그번호
HPA030165-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030165-100 Anti-TJAP1 Antibody, tight junction associated protein 1 (peripheral) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030165-25 Anti-TJAP1 Antibody, tight junction associated protein 1 (peripheral) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TJAP1 Antibody

Anti-TJAP1 Antibody

Target: Tight junction associated protein 1 (peripheral)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TJAP1.

Alternative Gene Names

  • PILT
  • TJP4

Open Datasheet

Target Information

항목 내용
Target Protein Tight junction associated protein 1 (peripheral)
Target Gene TJAP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000012296 (88%), Rat ENSRNOG00000018980 (83%)

Antigen Sequence:
GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.