CacheBy
Atlas Antibodies Anti-TIMMDC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMMDC1 Antibody

상품 한눈에 보기

인간 TIMMDC1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 미토콘드리아 내막 전이효소 복합체 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053214-100 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053214-25 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMMDC1 Antibody

Anti-TIMMDC1 Antibody

Target: translocase of inner mitochondrial membrane domain containing 1 (TIMMDC1)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TIMMDC1.

Alternative Gene Names

C3orf1, FLJ22597

Open Datasheet

Target Information

  • Protein: translocase of inner mitochondrial membrane domain containing 1
  • Gene: TIMMDC1
  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000002846 64%
Rat ENSRNOG00000002999 60%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.