CacheBy
Atlas Antibodies Anti-TIMMDC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMMDC1 Antibody

상품 한눈에 보기

인간 TIMMDC1 단백질에 대한 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 고순도 친화 정제 방식으로 제작되었으며, 미토콘드리아 내막 단백질 연구에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055846-100 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055846-25 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMMDC1 Antibody

Anti-TIMMDC1 Antibody

Full name: translocase of inner mitochondrial membrane domain containing 1 (TIMMDC1)


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TIMMDC1.


Alternative Gene Names

C3orf1, FLJ22597

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane domain containing 1
Target Gene TIMMDC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK
Verified Species Reactivity Human
Ortholog Identity Mouse (ENSMUSG00000002846, 64%), Rat (ENSRNOG00000002999, 60%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.