
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TIMMDC1 Antibody
상품 한눈에 보기
인간 TIMMDC1 단백질에 대한 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 고순도 친화 정제 방식으로 제작되었으며, 미토콘드리아 내막 단백질 연구에 활용됩니다.
- 카탈로그번호
- HPA055846-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055846-100 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055846-25 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TIMMDC1 Antibody
Anti-TIMMDC1 Antibody
Full name: translocase of inner mitochondrial membrane domain containing 1 (TIMMDC1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TIMMDC1.
Alternative Gene Names
C3orf1, FLJ22597
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of inner mitochondrial membrane domain containing 1 |
| Target Gene | TIMMDC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse (ENSMUSG00000002846, 64%), Rat (ENSRNOG00000002999, 60%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



