CacheBy
Atlas Antibodies Anti-TIMMDC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMMDC1 Antibody

상품 한눈에 보기

인간 TIMMDC1 단백질에 대한 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 고순도 친화 정제 방식으로 제작되었으며, 미토콘드리아 내막 단백질 연구에 활용됩니다.

카탈로그번호
HPA055846-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055846-100 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055846-25 Anti-TIMMDC1 Antibody, translocase of inner mitochondrial membrane domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMMDC1 Antibody

Anti-TIMMDC1 Antibody

Full name: translocase of inner mitochondrial membrane domain containing 1 (TIMMDC1)


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TIMMDC1.


Alternative Gene Names

C3orf1, FLJ22597

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane domain containing 1
Target Gene TIMMDC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK
Verified Species Reactivity Human
Ortholog Identity Mouse (ENSMUSG00000002846, 64%), Rat (ENSRNOG00000002999, 60%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.