CacheBy
Atlas Antibodies Anti-TIGAR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIGAR Antibody

상품 한눈에 보기

Human TIGAR 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존제가 포함되어 있습니다. TP53 유도 해당과정 조절 인산가수분해효소 검출에 사용됩니다.

카탈로그번호
HPA044111-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044111-100 Anti-TIGAR Antibody, TP53 induced glycolysis regulatory phosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044111-25 Anti-TIGAR Antibody, TP53 induced glycolysis regulatory phosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIGAR Antibody

Anti-TIGAR Antibody

TP53 induced glycolysis regulatory phosphatase

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TIGAR.

Alternative Gene Names

  • C12orf5

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein TP53 induced glycolysis regulatory phosphatase
Target Gene TIGAR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTET
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000051816 (61%), Mouse ENSMUSG00000038028 (61%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.