CacheBy
Atlas Antibodies Anti-TICRR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TICRR Antibody

상품 한눈에 보기

Human TICRR 단백질을 인식하는 Rabbit Polyclonal 항체로, TOPBP1 상호작용 및 복제 조절 단백질 연구에 적합. PrEST 항원으로 친화 정제되었으며, ICC 등 다양한 응용에 사용 가능. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046746-100 Anti-TICRR Antibody, TOPBP1 interacting checkpoint and replication regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046746-25 Anti-TICRR Antibody, TOPBP1 interacting checkpoint and replication regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TICRR Antibody

Anti-TICRR Antibody

TOPBP1 interacting checkpoint and replication regulator


  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human TICRR


Alternative Gene Names

C15orf42, FLJ41618, MGC45866, SLD3, Treslin

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein TOPBP1 interacting checkpoint and replication regulator
Target Gene TICRR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000046591 (44%), Rat ENSRNOG00000015520 (43%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.