
Merck Anti-GLUL antibody produced in rabbit
Rabbit에서 생산된 Anti-GLUL 항체로, 인간 GLUL 단백질에 특이적입니다. Prestige Antibodies® 라인 제품으로 면역형광 및 면역조직화학 분석에 적합합니다. 친화 분리된 항체 형태로, buffered aqueous glycerol 용액에 포장되어 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-GLUL antibody produced in rabbit
Anti-GLUL antibody produced in rabbit
제품 개요
Ab2, Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
동의어:
Anti-GS antibody produced in rabbit
Anti-Glutamate--ammonia ligase antibody produced in rabbit
Anti-Glutamine synthetase antibody produced in rabbit
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:500–1:1000
면역원 서열
RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Human GLUL (glutamate-ammonia ligase)
GLUL gene encodes an ATP-dependent enzyme that catalyzes the synthesis of glutamine from glutamate and ammonia (nitrogen source).
It is a member of the glutamine synthetase family.
제품 사양 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Package Size | 25 μL |
| Techniques | IF (0.25–2 μg/mL), IHC (1:500–1:1000) |
| Storage | −20°C |
| Shipping | Wet ice |
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



