
Merck Anti-ACKR2 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-ACKR2 rabbit polyclonal antibody는 인간 ACKR2 단백질 검출용 1차 항체로, Affinity purified Prestige Antibodies® 제품입니다. 면역조직화학(IHC)에 적합하며, buffered glycerol 용액 형태로 −20°C에서 보관합니다.
브랜드: Merck Sigma
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACKR2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
- Source: Rabbit
- Clone: Polyclonal
- Product type: Primary antibody
- Conjugation: Unconjugated
- Form: Buffered aqueous glycerol solution
- Species reactivity: Human
- Product line: Prestige Antibodies® Powered by Atlas Antibodies
- Packaging: Small pack of 25 μL
향상된 검증
Orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Technique(s) | Immunohistochemistry: 1:50–1:200 |
| Immunogen sequence | QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA |
| Shipping condition | Wet ice |
| Storage temperature | −20°C |
유전자 정보
- Gene: human CCBP2 (1238)
- Gene description: The gene ACKR2 (atypical chemokine receptor 2) is mapped to human chromosome 3p21. It encodes a protein containing a conserved tyrosine motif at the N terminus that is involved in ligand binding, internalization, and scavenging. It is expressed in barrier tissues such as skin, gut, lung, and syncytiotrophoblast layer of the placenta. In adults, it is expressed on lymphatic endothelial cells, leukocytes, and keratinocytes.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




