Merck Anti-PAPPA2 antibody produced in rabbit

Anti-PAPPA2 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

생물학적 정보

• Source: Rabbit
• Clonality: Polyclonal
• Conjugation: Unconjugated
• Antibody Type: Primary antibody
• Form: Buffered aqueous glycerol solution
• Species Reactivity: Human

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

포장

Antibody small pack of 25 μL

향상된 검증 (Enhanced Validation)

• Orthogonal RNAseq
• Independent
  자세한 내용은 Antibody Enhanced Validation 참고

적용 기술

• Immunohistochemistry: 1:20–1:50

면역원 서열

GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLQGFE

UniProt 수납 번호

Q9BXP8

품질 수준

100

배송 및 보관

• Shipping Condition: Wet ice
• Storage Temperature: −20°C

유전자 정보

• Gene: PAPPA2 (60676)
• Organism: Human
• Chromosomal Location: 1q25.2
• Expression: Abundant in placenta and non-pregnant mammary gland; low in kidney, fetal brain, and pancreas
• Variants: Two protein variants exist due to alternative splicing — the longer variant is nuclear, the shorter is secreted extracellularly

제품 스펙 요약