
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-TRIOBP antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-TRIOBP 항체는 rabbit에서 생산된 polyclonal primary antibody로, 인간 TRIOBP 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, immunoblotting 및 immunohistochemistry에 적합합니다. −20°C에서 보관하며, orthogonal RNAseq로 검증되었습니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TRIOBP antibody produced in rabbit
Anti-TRIOBP antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Product type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Validation | Orthogonal RNAseq (Antibody Enhanced Validation) |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:50–1:200 |
| Immunogen sequence | EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL |
| UniProt accession | Q9H2D6 |
| Shipping conditions | Wet ice |
| Storage temperature | −20°C |
| Gene information | Human TRIOBP (11078) |
추가 정보
TRIO and F-actin-binding protein recombinant protein epitope signature tag (PrEST)
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



